PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr017848.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NF-YB
Protein Properties Length: 266aa    MW: 28727.2 Da    PI: 6.1596
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr017848.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB144.72.1e-4568162296
        NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                  r q +++P anv+rim++vlP +aki+++aketvqecvse+i+f+t+ea++++q e+rkt++++d++wa+++lGfe+yv+pl+v+l++yre e+ 
  Pbr017848.1  68 RVQHQHMPTANVVRIMRRVLPPHAKITEAAKETVQECVSEYIAFITAEANQRSQGEQRKTVSAEDIIWAMSKLGFENYVDPLNVFLHRYRESENS 162
                  67899**************************************************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.8E-4164169IPR009072Histone-fold
SuperFamilySSF471131.24E-3172175IPR009072Histone-fold
PfamPF008086.7E-2173137IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.4E-14101119No hitNo description
PRINTSPR006156.4E-14120138No hitNo description
PRINTSPR006156.4E-14139157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MDAISTVGPN FSVLKKNRFI DTVARGHAAP NSSDSGDGNA VGNTSTPANA TGSTGNNTAQ  60
STHRPVVRVQ HQHMPTANVV RIMRRVLPPH AKITEAAKET VQECVSEYIA FITAEANQRS  120
QGEQRKTVSA EDIIWAMSKL GFENYVDPLN VFLHRYRESE NSDRSQFMKR EHPLMDYGPA  180
VPSGPAGPQV AMMPPPLLPP FVPEFPLGFE QRGPPMLDPS MIEMFLDGGS STGAAEGGSS  240
SSFGAQDQNW LGDLIRRLSP SDQPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B8e-3367158192Transcription factor HapC (Eurofung)
4g92_B8e-3367158192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009375082.11e-175PREDICTED: nuclear transcription factor Y subunit B-9-like
SwissprotQ9SFD82e-48NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLM5WRR43e-59M5WRR4_PRUPE; Uncharacterized protein (Fragment)
STRINGfgenesh2_kg.1__2386__AT1G21970.13e-46(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3809822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.14e-49NF-YB family protein